SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014279 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014279
Domain Number 1 Region: 140-279
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 614-782
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.19e-31
Family AlaX-like 0.02
Further Details:      
 
Domain Number 3 Region: 377-486
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000000000000222
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.003
Further Details:      
 
Domain Number 4 Region: 539-614
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000953
Family AlaX-M N-terminal domain-like 0.0072
Further Details:      
 
Domain Number 5 Region: 34-76
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.000000204
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014279   Gene: ENSTBEG00000016385   Transcript: ENSTBET00000016430
Sequence length 974
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4761:107769:174797:-1 gene:ENSTBEG00000016385 transcript:ENSTBET00000016430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVVAAAERLRRAIRRSPPWRSPSHRPLSTRASAVRDAFLSFFRDRHGHRLVPSASVR
PRGDPSLLFVNAGMNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXEEACCMAWELLTQVYGIPEDRLWVSFFGGDPKAGLEPDLE
SRDIWLNLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVELWNLVF
MQHNREADGSLQPLPQRHVDTGMGLERLVAVLQGRRSTYDTELFFPLLNAIHQGCRAPPY
LGRVGVADEGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXGDAYPELQKNSAQIANLVSEDEEAFLASLQRGRRIIDRTLKH
LGPSDMFPAEVAWSLSLSGNLGLPLDLVELMLEEKGVQLDTAGLERLAQEEAQHRAQQAG
PAQQALRLDVHALGELRRRGVRPTDDSPKYNYSLGPSGGYEFGTCEAQVLQLYTEDGTAV
ASIGEGQRGGLLLDRTNFYAEQGGQASDRGYLVRVEQQDVLFPVARAQVCGGFILHEVVA
PECLQVGDQVQLHVDEAWRLGCMEKHTATHLLNWALRQALGPGTEQRGSHLSPERLRFDV
ASQAPLTPEQLRTVEGIVQEAVQQDKAVYVEEVALALTAQVPGLRSLDEVYPDPVRVVSV
GVPVAHALDPTSQASLQTSVELCCGTHLLRTGTLGDLVIIGERQLAKGTTRLLAITGEQA
RQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDTALMPQWQRRELQTL
KGLQRRNTAIRKVEMGQAAKKTQELLERHAKGPLIVDTVSAESLSVLVKVVRQLCEVPST
SVLLLSPQPVWNVLCACQVAGATSTFTAQAWALAVCSHMGGKAWGSRVMAQGTGSTTDLE
AALSAARAYALSQL
Download sequence
Identical sequences ENSTBEP00000014279 ENSTBEP00000014279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]