SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014292 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014292
Domain Number 1 Region: 1728-1817
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-21
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 271-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000149
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 891-1003
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 153-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000285
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 426-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 6 Region: 257-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000124
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 584-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 767-880
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000471
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 999-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000706
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 10 Region: 189-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000616
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1211-1241
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 12 Region: 469-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 13 Region: 230-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.049
Further Details:      
 
Domain Number 14 Region: 1248-1278
Classification Level Classification E-value
Superfamily Notch domain 0.0000562
Family Notch domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000014292
Domain Number - Region: 1040-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000371
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1129-1167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00086
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1170-1199
Classification Level Classification E-value
Superfamily Notch domain 0.0116
Family Notch domain 0.0036
Further Details:      
 
Domain Number - Region: 1084-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0623
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014292   Gene: ENSTBEG00000016392   Transcript: ENSTBET00000016445
Sequence length 1997
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4213:53039:98827:-1 gene:ENSTBEG00000016392 transcript:ENSTBET00000016445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPLLLLLLLHFSTAMARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEQCQLRDFCSANPCTNGGVCLATYPHIQCRCPPG
FEGLVCEHDIKECFLNRAPCPRGTSCHNTLGSFQCLCTRRAGTRCELRAGPCPTGGCPHG
GTCQLVPRGNSTFHRCVCPPGFTGLDCEVNPDNCIGHQCQNGGTCLDGLDSYTCLCPEAW
TGWDCSEDVDECEARGAPRCRNGGTCQNAAGSFHCVCVSGWGGPGCDENLDDCLAATCAP
GSTCVDRVGSFSCLCPPGLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGYSG
PTCHQDSDECQMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCRP
GSTCLDLLATFHCLCPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDECLSDPCPTGSSFLD
LPGAFFCLCPSGFTGQLCEVPLCAPSLCQPEQPCQDEENKALCLCPDGSPGCVPAHNCTC
HRGHCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCLHGGTCVNRPG
AFSCLCASGFQGLHCEGRSRPSCADSPCRNRATCQDGPQGPRCLCPPGYTGGSCQTLVDL
CAQKPCPANSHCLQSGPSFQCLCLQGWTGPLCKLPLSSCQKAALSQGIEVSSLCQNGGLC
IDSGPSHFCRCPPGFQGNLCQDSVNPCESRPCQHGATCVAQPSGYLCQCAPGYSGQNCSE
EPDACASQPCHNQGTCTPRPGGFHCACPPGFVGPRCEGDVDECLDRPCHPRGTAACHSLA
NAFYCQCLPGHTGQWCEVEIDPCQSQPCSHGGSCEATARPPPGFTCRCLSVAGFEGPTCS
QRAPSCGAHHCHHGGLCLPSPKPGLAPHCACLNGYGDPDCLTPPAPKGCGPPSPCLHNGS
CSETPGLGGPGFRCSCPPNSPGPQCQRPGAQGCEGRGGDGACDAGCSGPGENWDGGDCSL
GVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPAACTPAYDQYCRDHFNG
HCEKGCNTAECGWDGGDCRPADGGSQWGPSLALLVVLSPPSLEQQLLALARALSLTLRVG
LWVRKDSDGRDMVYPYPGARAEEELGGTGGHSQPETAAPHTQPLGKEADPLHAGFVVVMG
VDLSRCGPDHSASHCPWDPGLLLRFLAALAAVGALEPLLPGPLLAAHPHAGTAPPVKQLP
WPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTRPTPRRRRPPLGE
DSIGLKALKPEAEVDEDGVVMCSGPEEGEDMGQAEETAPASKCQLWPLSSGCGELPQAAM
LTPPQEAELEVSEVDTCGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTALHWAAAVNN
ARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLGLGAARGLRDQAGLTPADI
ARRRNHWDLLTLLEGAGPPEARHKATPGGEVGALPRARTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLSAGMRGPGPT
LAVAQGRPALATWRPDRASADACSCDWVALGSCGPASNTPIPPPCLTPSPDPGSPQVVWG
PPGHPVMSLNPGGEDAK
Download sequence
Identical sequences ENSTBEP00000014292 ENSTBEP00000014292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]