SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014313 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014313
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Lysozyme-like 1.41e-32
Family C-type lysozyme 0.0000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014313   Gene: ENSTBEG00000016481   Transcript: ENSTBET00000016467
Sequence length 77
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5557:57447:58177:-1 gene:ENSTBEG00000016481 transcript:ENSTBET00000016467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICTIFHTSGFDTQAKVSNNGSTEYGLFQISNKHWCKSEQIPQSKNICNIPCEKLLNDDLT
DDIACAKKILDRKGMGY
Download sequence
Identical sequences ENSTBEP00000014313 ENSTBEP00000014313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]