SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014504 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014504
Domain Number 1 Region: 5-254
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.59e-24
Family FAD-linked reductases, N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 236-340
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.12e-19
Family L-aminoacid/polyamine oxidase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014504   Gene: ENSTBEG00000016685   Transcript: ENSTBET00000016680
Sequence length 340
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5202:136102:140412:1 gene:ENSTBEG00000016685 transcript:ENSTBET00000016680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSELGFDSEVLPVREHPAALNRFLYVGGALHALPTGLRGLLRPSPPFSKPLFWAGLRELT
QPRGKEPDETVHSFAERRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHR
SILLGLLLGAGQSPQPDSALIRQARAERWSQWSLRGGLEMLPQALDTHLTNRGVNILRGQ
PVCGFSLQAEGRWKVSLGDSSLEADHIISAIPASALSELLPAEAAPLAGVLRTISAVSVA
VVNLQYRGARLPVQGFGHLVPSAEDPGVLGIVYDSVAFPEQDGSPPGLRVTVMLGGSWLQ
TLAAGGALSQELFQQQAQEAAATQLGLKEPPSHCLVHLHK
Download sequence
Identical sequences ENSTBEP00000014504 ENSTBEP00000014504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]