SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014699 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014699
Domain Number 1 Region: 1-104,141-313
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-63
Family Phosphofructokinase 0.00000956
Further Details:      
 
Domain Number 2 Region: 509-684
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.66e-39
Family Phosphofructokinase 0.00088
Further Details:      
 
Domain Number 3 Region: 341-429
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.62e-22
Family Phosphofructokinase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014699   Gene: ENSTBEG00000016861   Transcript: ENSTBET00000016907
Sequence length 689
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2850:76816:95681:1 gene:ENSTBEG00000016861 transcript:ENSTBET00000016907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAVRAVTRMGIYVGAKVFLIYEXXXXXXXXXXXXXXXXXXXXXXXXXXGGTVIGSARC
KAFTTREGRLAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGGLLEELAREGKISEAT
TRYSHLIALVLIDDFCTDMIVDSLHIMVIDITTAQSHQRTFVLEVMGRHCGYLALVSALA
SGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDRQGKPISSSYVKDL
VVQRLGFDTRVTVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQ
SVRLPLMECVQVXXXXXXXXXXXXXXXXXXXXXXSFENNWNIYKLLAHQKLSKEKTNFSL
AILNVGAPAAGMNAAVRSAVRTGISQGHTVYVVHDGFEGLAKGQVQVVGWHDVAGWLGRG
GSMLGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSCDRIKQSASGTKRRVFIVETMGGYCGYLATV
TGIAVGADAAYVFEDPFNIHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYSTEFLYNL
YSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRAVYRKGRVFAN
APDSACVIGLQKKTVAFSPVTELKKDTDF
Download sequence
Identical sequences ENSTBEP00000014699 ENSTBEP00000014699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]