SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014742 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014742
Domain Number 1 Region: 59-429
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-75
Family Ankyrin repeat 0.0000236
Further Details:      
 
Domain Number 2 Region: 535-583
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000536
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014742   Gene: ENSTBEG00000016958   Transcript: ENSTBET00000016957
Sequence length 585
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_146221:15146:36162:-1 gene:ENSTBEG00000016958 transcript:ENSTBET00000016957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRFSYAEYFALFHSCSAPSRSSAPPASSTAPAPAPAPRGLFQEVMQKFKASQLAAVDPV
LKAIKEGDEEALKAMIKEGKNLAEPNKEGWLPLHEAAYYGQLGCLRVLQQAYPAAVDQRT
LQEETALYLATCREHLDCLRSLLQAGAEPDISNKSRETPLYKACERKNVEAVRILVQHSA
DTNHRCNRGWTALHESVSRNDLEVMEVLVSGGAKVESKNAYGISPLFVAAQSGQLEALRF
LAKHGADINTQASDSASALYEACKNGHEEVVEFLLSQGADANKANKDGLLPLHVASKKGN
YRIVQMLLPVTSRTRVRRSGISPLHLAAERNHDAVLEALLGARFDVNAPLAPERARLYED
RRTSALYFAVVNNNVYATELLLLAGADPNRDVINPLLVAIRHGCLRTMQLLLDHGANIDA
YIATHPTAFPATIMFAMKCLSLLKFLMDLGCDGEPCFSCLYGNGPHPPAPARSSRFNDVP
AADKAPGVMQFCEILSAPEVSWAGPIIDVLLDYVGNVQLCARLKEHIDSYADWAVIKEKA
EPPRPLAHLCRLRVRKAIGKCRIKLLDTLPLPGRLIRYLKYENTQ
Download sequence
Identical sequences ENSTBEP00000014742 ENSTBEP00000014742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]