SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014891 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014891
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-106
Family Calpain large subunit, catalytic domain (domain II) 0.000000000563
Further Details:      
 
Domain Number 2 Region: 253-338
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.83e-27
Family Calpain large subunit, middle domain (domain III) 0.00000485
Further Details:      
 
Domain Number 3 Region: 533-588
Classification Level Classification E-value
Superfamily EF-hand 0.000000000041
Family Penta-EF-hand proteins 0.0022
Further Details:      
 
Domain Number 4 Region: 424-484
Classification Level Classification E-value
Superfamily EF-hand 0.000000000338
Family Penta-EF-hand proteins 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014891   Gene: ENSTBEG00000017114   Transcript: ENSTBET00000017133
Sequence length 591
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_109:3310:62914:1 gene:ENSTBEG00000017114 transcript:ENSTBET00000017133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDG
KLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSD
LYNIILKALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYRGQMVNLIR
MRNPWGEVEWTGAWSDGSSEWNNVDPYEREQLRIKMEDGEFWMSFRDFMREFTRLEICNL
TPDALKSRTIRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDEVDDADDYGDR
ESGCSFVLALMQKHRRRERRFGRDMETIGFAVYEVRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
KVLSEEEIDENFKALFRQLAGEDMEISVRELQTILNRIISKHKDLRTKGFSLESCRSMVN
LMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKLNKKL
YELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFK
Download sequence
Identical sequences ENSTBEP00000014891 ENSTBEP00000014891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]