SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014918 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014918
Domain Number 1 Region: 201-397
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 5.89e-40
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0001
Further Details:      
 
Domain Number 2 Region: 17-200
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-32
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000444
Further Details:      
 
Domain Number 3 Region: 527-689
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.97e-22
Family AlaX-like 0.036
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000014918
Domain Number - Region: 456-522
Classification Level Classification E-value
Superfamily Translation proteins 0.00388
Family AlaX-M N-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014918   Gene: ENSTBEG00000017122   Transcript: ENSTBET00000017163
Sequence length 882
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_124815:10575:13318:1 gene:ENSTBEG00000017122 transcript:ENSTBET00000017163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKLIFLNTNDLSNPMAKLNRDANTKKCIQACRGDKHKDLDDVGKYHHTFFEMLDSFGNYF
KELVCMTLKLLIKDFGIPSEILHVTCLGGEAVGSDLEKQIWKNLGLENKTLSGNMKLNFE
MGDTSLCGSCREINFDWISGPNTTYLVNQDDPNLLEIWNLVFIQYNRGTDDILKPLPKKS
IDPGMGLQLAFLLQNKMSNYDTDLFVPCFEPIQKSTGALYTAKDGTDNADGIIMVYGVLT
DHAQTITVALADGSQPDNKGQGYMLRWILHQAVCHSHEKLNSSRGFFAILVDFVVRSLGD
AFPEVKKDPDMVKDIINEEKAQFLKTLSGHHILDRKIQSLRDHKTISSDTAWLLYDIYRL
HMDLTRLITEEKGLLVDIHGFEEERKLAQLKSKDKAGGDDLIMPDIYAIEFWANGLEATD
DSSKYNYHNSSGNYFDSAVAIVLALCREMLAEDVFTGQECGVVLDKTCFYAKQIYEEGYL
VKADDSSEDKTKFTVNSTQVGGCMLPIGTIYGHLKVGDQVQLFNEPRWRSVMSNHATYIM
NFTLHCVLREADRKGYLVAPDCLQFDFTTKGAMSILQIKKVEDIVNETIKAAKPVYNQGY
PLVAAKAIQGLQAVFDETHPDPVEVISIVVPMFELLDDPSGPASSLTSVEFCGTTHLWNS
SSMGAFVIITEEAIAKGIWRIIVITGAEAQKALRKEILKRSLSAMEAKVKTQITLNKDVQ
REIDNLALAVFPPWQKDKLWEMLKSLKKVMDDLDPANKTDVQKRVLEKIKQFLNSNPNKP
LLILEMESGTLVLFNTHSPQMSIMLVMVGNKVSKITCLCQVPQNAANRGLKLSEVQQVSG
LMDCKGSVKGMSTQAMVMNVGCLQEVLQLATSFALLGDVKNS
Download sequence
Identical sequences ENSTBEP00000014918 ENSTBEP00000014918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]