SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014953 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014953
Domain Number 1 Region: 5-46
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000000000327
Family Skp1 dimerisation domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014953   Gene: ENSTBEG00000017216   Transcript: ENSTBET00000017201
Sequence length 46
Comment pep:novel scaffold:TREESHREW:scaffold_111985:76908:77045:1 gene:ENSTBEG00000017216 transcript:ENSTBET00000017201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEERTDDIPVWDQEFLKVDQETLFELILGANYLDIKGLLDVTCKTV
Download sequence
Identical sequences ENSTBEP00000014953 ENSTBEP00000014953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]