SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000015058 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000015058
Domain Number 1 Region: 143-440
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-108
Family Transglutaminase core 0.000000000205
Further Details:      
 
Domain Number 2 Region: 2-141
Classification Level Classification E-value
Superfamily E set domains 4.2e-44
Family Transglutaminase N-terminal domain 0.00000624
Further Details:      
 
Domain Number 3 Region: 508-586
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.76e-19
Family Transglutaminase, two C-terminal domains 0.0000258
Further Details:      
 
Domain Number 4 Region: 589-636
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000000235
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000015058   Gene: ENSTBEG00000017304   Transcript: ENSTBET00000017316
Sequence length 639
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5512:518364:561563:1 gene:ENSTBEG00000017304 transcript:ENSTBET00000017316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALELQNFNWQVSSNRQAHHTDKFSSQNLICRRGQPFFVLMTFNRKFGSGDDLSFTVLT
GPAPSESAKTKAVFPLSSGTNSGGWSARLENNNNNNLAVAISSPANAPIGLYTLNLQISS
QGSVSSLKLGTFMLLFNPWQQADSVFMGNHAEREEYVQEDAGIIFVGSTNRISMVGWNFG
QFEDDILSISLAILDRSLNYRRDAATDVARRGDPKYVCRVLSAMINSNDDNGVLAGNWSG
DYTGGRDPRNWNGSVEILKEWKRTGFRPVRFGQCWVFAGTLNTVMRSLGIPARVITNFNS
AHDTDRNLSVDVYYDSMGNPLDKGSDSVWNFHVWNEAWFVRTDLGPSYSGWQVLDATPQE
RSQGVFQCGPASVIAVKEGDVNLDFDMPFVFSEDADRTTWIEDPSRTQRSVDRFVRYIST
KAVGSNSRVDVTEKYKYPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTVNMTAWTIVYNGTLVHEVFKDSITVSLDP
EEETQHPVKIPYARYDKYLKADNMIRITAVCQVPDEDEVVVGRDVILDNPTLTLEVMDQA
HVKKPAIVRMLFSNPLDQPVNNCVLMVKGSGLLLGNLKI
Download sequence
Identical sequences ENSTBEP00000015058 ENSTBEP00000015058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]