SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000015160 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000015160
Domain Number 1 Region: 453-483,522-586
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000106
Family Anti-sigma factor antagonist SpoIIaa 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000015160   Gene: ENSTBEG00000017419   Transcript: ENSTBET00000017431
Sequence length 619
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3432:284107:432502:1 gene:ENSTBEG00000017419 transcript:ENSTBET00000017431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENLLPDTVSGIRLGVQQVTQGLAFAILSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTF
ALTSLISANAVERLVPQSVQNLTTQSNTSVLGLSDFEVQRISVAAAVSFLGGVIQVVMFV
LHLGSITFLLTEPVISAMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIK
SVRLEALLLSLLSIVVLVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGL
EVVGHIPKGIPPPRAPPMNILSAVITEAFGVALVGYAASLALAQGSAKKFKYSVDDSQEF
LAHGLSNVIPSFFFCIPSAAAMGRTAGLYSTGAKTQVACLISCILVLIVIYAVGPLLYWL
PMCVLASIIVVGLKGMLIQFRDLKKYWNVDKIDWGIWVSTYIFTICFAANVGLLFGVICT
IAIVIGRFPRARTLNIKNMKEMEFKVKTETDGETLQQVKIISINNPLVFLNAKKFHTDLM
NIIQKEDASNQPPDDISKXXXXXXXXXXXXXXXXXEASQSCANEKCSLILDCSGLTFFDY
SGVSMLVEAYMDCKDKSVDVSLVHCTASLIKAMKYRGNLDTEKPIFFESVPAAVSHIHLN
KSSYEKLLNNLDFTISLLR
Download sequence
Identical sequences ENSTBEP00000015160 ENSTBEP00000015160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]