SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000015406 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000015406
Domain Number 1 Region: 1-273
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.51e-103
Family Calpain large subunit, catalytic domain (domain II) 0.000000000213
Further Details:      
 
Domain Number 2 Region: 277-434
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.31e-58
Family Calpain large subunit, middle domain (domain III) 0.0000000281
Further Details:      
 
Domain Number 3 Region: 445-507
Classification Level Classification E-value
Superfamily EF-hand 0.000000015
Family Penta-EF-hand proteins 0.0000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000015406   Gene: ENSTBEG00000017710   Transcript: ENSTBET00000017715
Sequence length 621
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3163:27980:116743:1 gene:ENSTBEG00000017710 transcript:ENSTBET00000017715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EICADPQFIVGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLEQSFQENYAGIF
HFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGA
TTEGFEDFTGGIAEWYELKKPPPDLFRIIQKALLKGSLLGCSIDITSAADSEAITYQKXX
XXXXXXXXXXXXVESSGSLQKLIRIRNPWGEVEWTGKWNDNCPSWNTIDPEERERLTRRH
EDGEFWMSFNDFLRHYSRLEICNLTPDTLTSDSYKKWKLTKMEGSWRRGSTAGGCRNYPN
TFWMNPQYLIKLEEEDEDQEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEE
LTGQTNIHLSKNFFLRTRARERSDTFINLREVLNRFKLPPGEYVLVPSTFEPNKDGDFCV
RVFSEKKADYQVVDDEIEANIEEIDVSEDDIDDGFRRLFAQLAGEDAEISAFELQTILRR
VLAKRQDIKTDGFSIETCKIMVDMLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXWLCFSVL
Download sequence
Identical sequences ENSTBEP00000015406 ENSTBEP00000015406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]