SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000015408 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000015408
Domain Number 1 Region: 1800-2046
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 439-554
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000124
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 1126-1249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 4 Region: 891-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000804
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 928-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000215
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 6 Region: 1005-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000518
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 7 Region: 775-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000536
Family EGF-type module 0.006
Further Details:      
 
Domain Number 8 Region: 853-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000318
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 9 Region: 587-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 10 Region: 128-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.016
Further Details:      
 
Domain Number 11 Region: 550-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000464
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 242-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 624-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000714
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 14 Region: 963-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000074
Family EGF-type module 0.005
Further Details:      
 
Domain Number 15 Region: 273-401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000111
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 164-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000116
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 17 Region: 815-858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 18 Region: 47-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.013
Further Details:      
 
Domain Number 19 Region: 204-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 20 Region: 1244-1288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000653
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 21 Region: 1286-1324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family EGF-type module 0.014
Further Details:      
 
Domain Number 22 Region: 1045-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.022
Further Details:      
 
Domain Number 23 Region: 1403-1435
Classification Level Classification E-value
Superfamily Notch domain 0.000000235
Family Notch domain 0.0015
Further Details:      
 
Domain Number 24 Region: 90-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 25 Region: 1482-1513
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 26 Region: 1356-1395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000695
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 27 Region: 1098-1134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.018
Further Details:      
 
Domain Number 28 Region: 10-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000602
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000015408
Domain Number - Region: 1445-1476
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000015408   Gene: ENSTBEG00000017705   Transcript: ENSTBET00000017717
Sequence length 2451
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2385:36398:215876:-1 gene:ENSTBEG00000017705 transcript:ENSTBET00000017717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAPARALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGT
CVAQAMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCLNGGTCHKLSRDTYECTCQVGFT
GKLCQWTDACLSHPCANGSTCTTVANQFSCKCLAGFTGQKCETDVNECDIPGRCQHGGTC
LNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCE
QNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNR
NGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCLCPEGKAGLLCHLDDA
CISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDIECSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQS
NPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCAT
GFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNEG
RCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCAHGVCMDGINRYSCVCSPGFTGQRCN
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNCQVNIDECA
SNPCLNQGTCFDDISGYTCHCALPYTGKNCQTILAPCSPNPCENAAVCKEAPNFESYTCL
CAPGWQGQRCTVDIDECVSKPCMNHGVCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPC
QNGGSCMDGVNTFSCLCLSGFHGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCPVGFD
GVHCENNIDECTESSCFNGGTCVDGINSFSCLCPMGFTGPFCLHKINECNSHPCLNEGTC
VDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKAESRCLCPSGWAGAYCDV
PSVSCEVAASRRGVPVDRLCQHSGICISAGSTHHCQCPLGYTGSYCEEQLDECASNPCQH
GATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQHGGTCVDLVNHFKCSCPPGTRGL
LCEENIDDCAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCEGDINECLSNPCSSEGSLD
CIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGA
RCQSSCGQVKCRRGERCVHTPSGPRCFCPNPQDCESGCASSPCQHGGSCHPQRQPPYYSC
QCSPPFGGSHCEFYTPPSTPPATCLSQYCADKARDGVCDDACNSHACQWDGGDCSLTMEN
PWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGTSKTCKYDKYCADHFKDNHCDQG
CNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKR
DPQGDLMVYPYYSETSAAMKRRKMARRSLPGAPMRREVDGSKVFLEIDNRQCVQDSDQCF
KNTDAAAALLASHAIQGTLSYPLVSVISDSLAPKRTQLLYLLAVAVVIILFIILLGVIMA
KRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVD
DEGPQPKKAKAEDEALLSEDDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLD
VNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMA
LHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDAR
MNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATVLLLKNG
ANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVR
LLDEYNVTPSPPGTVLASALSPVICGPNRSFLSLKHTPMGKKPRRPNAKSTMPTSLPNLA
KEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMITSPGVLQASP
NPLLAPAAPAAPVHAQHALSFSNLHEMQPLAHGANTVLPSVSQLLSHHHIVPPGSGSAGS
LGRLHPVSVQADWMNRMEINETQYNDMFGMVLAPAEGTHPGMAPQSRPPEGKHLTTPREP
LPPIVTFQLIPKGSIAQPTGAPQPQSNCPPAVAGSLSTMYQIPEMARLPSVAFPTAMMPQ
QDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPE
SPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMSEPPHSNMQVYA
Download sequence
Identical sequences ENSTBEP00000015408 ENSTBEP00000015408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]