SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000015444 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000015444
Domain Number 1 Region: 477-606
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.37e-51
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 125-229
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000334
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000168
Further Details:      
 
Domain Number 3 Region: 285-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000339
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000254
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000015444
Domain Number - Region: 435-489
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00088
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000015444   Gene: ENSTBEG00000017750   Transcript: ENSTBET00000017755
Sequence length 611
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_617:122995:174747:-1 gene:ENSTBEG00000017750 transcript:ENSTBET00000017755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGGLKQKLVPLVRTECVRSPRQRNRLPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXKDDQKRYNERISGLGLTPEEKQKMATSSASEG
EPVPQVRVPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
SDDPNVXXXXXXXXXXXXXXXIYFQPPSFYVSAQDLPHIENGGVAVLTGKKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGDFRALEKISREVK
SITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRRXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSM
FWSDGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEIT
IPPSAPAVPQAPVQGEDYGKGVVFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLN
EVAKLFNIHED
Download sequence
Identical sequences ENSTBEP00000015444 ENSTBEP00000015444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]