SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000015446 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000015446
Domain Number 1 Region: 207-286
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.35e-31
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 2 Region: 30-114
Classification Level Classification E-value
Superfamily PH domain-like 1.25e-27
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000015446   Gene: ENSTBEG00000017753   Transcript: ENSTBET00000017757
Sequence length 505
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3921:209980:279863:-1 gene:ENSTBEG00000017753 transcript:ENSTBET00000017757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDXXXXXXX
XXXXXXXXXXXXXVTDLLGRRQRKSERRRDLSNGPNLPMATVDIKNPEITTNRFYSSQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSREXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences ENSTBEP00000015446 ENSTBEP00000015446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]