SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002854 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002854
Domain Number 1 Region: 38-180
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-40
Family Phosphotyrosine-binding domain (PTB) 0.00000137
Further Details:      
 
Domain Number 2 Region: 372-485
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-23
Family SH2 domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002854   Gene: ENSTBEG00000003299   Transcript: ENSTBET00000003299
Sequence length 493
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3143:342:178806:-1 gene:ENSTBEG00000003299 transcript:ENSTBET00000003299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSAPILVAQGDSWHQAPRTHVMSAARKKRSSDETLLRSPRGAPHSSDQVLGAGVTYVVK
YLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFKKRKPPSKVLSSILGKSNL
QFAGMSTSLTISTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRR
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQSLDEPWTEEEGDGPD
RDRPYYNSIPSKMPPPGAFLDARLKTRTPVPDSAQFAGKEQTYYQGRHLGDTFGEDWQQA
PIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFEDA
LKNQSMGPTLSKAASVECISPVSPRAPDASMLEELKAEPWYQGEMNRKEAEGLLEKDGDF
LVRKSTTNPGSFVLGMHHGVKHLLLVDPEDTVRTKDRVFDSISHLINHHLQSGLPIVSAG
SELCLRQPVERKQ
Download sequence
Identical sequences ENSTBEP00000002854 ENSTBEP00000002854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]