SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003023 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003023
Domain Number 1 Region: 157-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.35e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.72e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.38e-22
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 5 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-21
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 7 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 9 Region: 115-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.9e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 10 Region: 80-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000187
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 260-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000255
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 344-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000443
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003023   Gene: ENSTBEG00000003506   Transcript: ENSTBET00000003486
Sequence length 596
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5352:13145:53610:-1 gene:ENSTBEG00000003506 transcript:ENSTBET00000003486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQELVTFRDVAIDFSQQEWEYLDPMQRDLYRDVMLENYGNLVSLAGDSISKPDVVDLLEQ
GKEPWTILSEGTQRPHADLINLHHRCHSIERTYACKECGKNFRSGYQLTLHQRFHSGEKP
YQCAECGRNFKSGYQLTVHQRFHTGEKTYECKECGKAFIYASHIVQHERVHTGGKPYECQ
QCGKTFSQSGHLRIHQRIHTGEKPYKCKDCGKTFSRRSNLVEHGQIHTSEKPHVCEKCGK
AFRRSHQLSVHQSVHTGKKPYECQECGKGYTTASYLTLHQRIHKGGKPYACKECKKTFTL
YRNLTRHQNIHTAEKLFKCKQCGKAYTMASKLFQHQKTHTGEKPYECKECGKAFSVYGYL
NQHQKIHIGLKRFECKECKKTFTLYRNLTRHQSIHTGKKVFECEKCGKAYSTGSNLVQHR
KTHTGEKPYECKECGKTFSLLGYLNQHQKIHTGLKPYECKVCRKTFTFYRNLTLHQSIHT
DEKPFECKECGKAFRRSSHLTAHQSIHAEKKPYECKECGKAFKMYGYLTQHQKIHTGDKP
YECNECGKSFSRASNLVQHERIHTGEKPYVCEQCGRTFRYGSALKAHQGFHMALKV
Download sequence
Identical sequences ENSTBEP00000003023 ENSTBEP00000003023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]