SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004098 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004098
Domain Number 1 Region: 5-46
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000123
Family Skp1 dimerisation domain-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004098   Gene: ENSTBEG00000004781   Transcript: ENSTBET00000004760
Sequence length 46
Comment pep:novel scaffold:TREESHREW:scaffold_80449:6879:7016:-1 gene:ENSTBEG00000004781 transcript:ENSTBET00000004760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKKRTDDIPVSDQEFLKDDQGTFFELILTTNCLDIKVLLDVACKTV
Download sequence
Identical sequences ENSTBEP00000004098 ENSTBEP00000004098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]