SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005042 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005042
Domain Number 1 Region: 1570-1827
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-42
Family YWTD domain 0.000025
Further Details:      
 
Domain Number 2 Region: 1320-1520
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-39
Family YWTD domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 220-449
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-37
Family YWTD domain 0.0000909
Further Details:      
 
Domain Number 4 Region: 529-789
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-35
Family YWTD domain 0.0000185
Further Details:      
 
Domain Number 5 Region: 3080-3266
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-25
Family YWTD domain 0.00016
Further Details:      
 
Domain Number 6 Region: 2326-2448
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-19
Family YWTD domain 0.0004
Further Details:      
 
Domain Number 7 Region: 2004-2120
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-18
Family YWTD domain 0.00026
Further Details:      
 
Domain Number 8 Region: 4009-4138
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000157
Family YWTD domain 0.00055
Further Details:      
 
Domain Number 9 Region: 3444-3486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000956
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 10 Region: 2884-2925
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 3561-3598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 3727-3766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 2753-2789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 3600-3636
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 15 Region: 3348-3388
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 3642-3686
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 17 Region: 1005-1041
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00029
Further Details:      
 
Domain Number 18 Region: 2796-2830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 2539-2580
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 20 Region: 3311-3346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 3524-3557
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 22 Region: 2580-2619
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 3390-3428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 1829-1879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000177
Family EGF-type module 0.014
Further Details:      
 
Domain Number 25 Region: 1090-1126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 3485-3523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 2633-2669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 28 Region: 2832-2873
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 29 Region: 2507-2541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 30 Region: 3764-3884,4130-4186
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 31 Region: 2958-2999
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000464
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 32 Region: 964-1004
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 1129-1165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 34 Region: 847-880
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 35 Region: 76-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000825
Family LDL receptor-like module 0.0044
Further Details:      
 
Domain Number 36 Region: 4258-4292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000898
Family EGF-type module 0.027
Further Details:      
 
Domain Number 37 Region: 2930-2970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000998
Family EGF-type module 0.022
Further Details:      
 
Domain Number 38 Region: 4357-4397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.033
Further Details:      
 
Domain Number 39 Region: 3689-3720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 40 Region: 2139-2180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000198
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 41 Region: 1531-1580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000461
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000005042
Domain Number - Region: 4221-4256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000108
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4183-4220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000291
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 482-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000914
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 2458-2517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0116
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4294-4326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 3282-3323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0599
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005042   Gene: ENSTBEG00000005667   Transcript: ENSTBET00000005859
Sequence length 4522
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4225:235477:2144969:-1 gene:ENSTBEG00000005667 transcript:ENSTBET00000005859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEFLLALLTLSGLLPGAEVLTLGADRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPKEVEIKCPLNHIACLGANKCVHLSQLCNAVWDCPDGYDEGVHCRXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXPTDRPPMLLIANSETNESFFLNGSKMATLSSVNGNEIHTLDF
IYNEDTICWIESRESSNQLKCIQITKTGRLTDEWTINILQSFHNVQQMAIDWLTRNLYFV
DHLSDRIFVCNYNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERCDMDGMN
RTRIIDSKTEQPAALALDLVNLVYWVDLYLAYVGVVDYQGKNRHTIIQGRQVRHLYGITV
FEDYLYATNSDNFDIMRINRFNVTDIHSLIKMENARGIRIYQKRTQPTVRSHACEVDPYG
MPGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDLN
TKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETILKDXXXXX
XXXXXXXXXXXXXXXXDGRKKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPVNGWMYW
TDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIEK
VFLNGTHRKIVYSGKELNHPFGLSHHGNYVFWTDYMNGSIFQLDLVTSEVTLLRHERPPL
FGLQIYDPRKQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXCKNRHCIQARWKCDGDDDCLDGSDEESITCXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXFPTCEPLTQFICKSGRCISSKWHCDSGNDDDCGDGSDEVGCVHSCFDSQFRCSSGRCI
PGHWACDGDNDCGDFSDETQINCTKKXXXXXXXXXGNEFQCPEKCIDLVRDGEKDVEDGS
EYACIAPLRLCDHKNKFSCRTGRCINKAWVCDGDMDCEDRSDEDDCDSFLCGPPKYPCAN
DTSVCLQPEQLCNGKRDCPDGSDEGDLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSA
IEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPRAIAL
DPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWTDAR
SDAIYSALYDGTKMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQNVSV
IQKTSAQPFDLQIYHPSRQPQAPNPCAAHDGKGPCSHMCLINHNRSAACACPHLMKLSSD
RKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTDI
KTQTIKRAFINGTGLETVISRDIQSIRRLAVDWISRNLYWISSEFDETQINVARLDGSLK
TSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSIDYVEN
KLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLGTCSK
RDGRNPTILRNKTSGVVHMKVYDKEAQQGSNSCQLNNGGCSQLCLPTSETTRTCMCTVGY
YLQKNRMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGASFAVGIDFHAXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXFLFWTEWGQMPCIGRARLDGSEKLVLVSMGIAWPNGI
SIDYEENKLYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVAVFGAYIYWSDRAHAN
GSVRRGHKNDATEAVTMRTGLGVNLKEVKVFNRVREKGTNVCAKDNGGCKQLCLYRGNSR
RACACAHGYLAEDGVTCRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYENPHYFKNVIA
LAFDYNQRRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMFWTNWNEQHPSIMR
STLTGKNAQVVVSTDILTPNGLTIDHRAEKLYFSDGSLGKIERCEYDGSQRYIIVKSGPG
TFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGIIAVANDTNSCELS
PCAILNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVTKNSSSNIYSEFECGNGECIDY
QLTCDGIPHCKDKSDEKLLYCEHRSCRRGFKPCYNRRCVPHGKLCDGENDCGDNSDELDC
KVSTCATIEFRCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFYKLGVKTTGFIRC
NSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYFXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAITCAADMF
SCQGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCHNKVCIPKQFVCDH
DDDCGDGSDESVQCGYRQCSAEEFSCADGRCLLNIQWQCDGDFDCPDHSDEAPLNPKCKS
AEQSCNSSFFMCNNGRCIPSRGLCDNKDDCGDGSDERNCHINECLSKKVSGCSQDCQDLP
VSYKVGCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCLNTYGTYKCLCTDGYEIKPDNP
NGCKSLSEEEPFLILADHHEIRKISTDGSNYTLLKQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKVNGLYPTIL
VSKRLKFPXXXXXXXXXXYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMALTIDYV
NHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRAHKTS
GADRLSLINSWHAITDIQVYHSYRQPDXXXXXXXXXXXXXXXLCLLAPGKTHTCACPTNF
YLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQPGRFQC
GTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQDDCGD
EEDEKDCRLWVGNADFRHAVASDKANCDKKTCGPHEFQCKNNNCIPDHWRCDSQNDCSDN
SDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDFDCADGSDESRDQFQCSNGQCISVKWK
CDGHEDCKYGEDEKNCEPASPTCSSSEYICASGGCISASLRCNGEYDCADGSDEMDCVTE
CKEDQFRCKNKAHCIPIRWLCDGSHDCVDGSDEENCDRGGNVCRADEFLCNNSLCKLHFW
VCDGEDDCGDNSDEAPDMCVKFLCPPTRPHGCRNNRICLQSEQMCNGIDDCGDNSDEDHC
SGKLTYKASPCKKDEFACSNKKCIPMDLQCDRLDDCGDGSDEQGCRITPSEYTCEDNVNP
CGDDAYCNQIKTSVFCRCKPGFQRNMKNRQCEDLNECLVFGTCSHQCINMKGSYKCVCDR
NFQERNNTCIAKGSEDQVLYIANDTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQ
RDMIIWSTQFNPGGIFYKRIHGREKRQANSGLIXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMYWTVIGDHSH
IEEAAMDGTLRRILVQKNLQRPTGLAVDHFSERIYWADFELSVIGSVLYDGSDSVVSVSS
KQGLLHPHRIDIFEDYIYGAGPKNGVFRIQKFGHGSVEYLALEVDKTKGVLISHRYKQLD
LPNPCLDLACEFLCLLNPSGATCVCPEGKDLINGTCNDDSMLDDSCKLTCENGGRCILNE
KGDLRCHCWPSYSGERCEVNHCSNYCQNGGTCIPSVLGRPTCRCALGFTGPNCGKIVCED
FCQNGGTCTVTAGNQPYCHCQPQYTGDRCQYYVCHHYCVNSESCTIGDDGSVECVCPPRY
EGPKCEVDKCVRCHGGHCIINKDSEDILCNCTNGKIASSCQLCDGYCYNGGTCQLDPETN
VPACLCSTNWSGTQCERPAPKSSKSDHISTXXXXIIVPLVLLVTLVTTLVIGLVLCKRKR
RTKTIRRQPIINGGINVEIGNPSYNMYEVDHEHSDGGLLDPGFMVDPTKARYIGGGPSAF
KLPHTAPPIYLNSDLKGPLTAG
Download sequence
Identical sequences ENSTBEP00000005042 ENSTBEP00000005042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]