SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006218 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006218
Domain Number 1 Region: 28-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.36e-46
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 251-291
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000301
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006218   Gene: ENSTBEG00000007207   Transcript: ENSTBET00000007199
Sequence length 293
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_919:263936:293968:-1 gene:ENSTBEG00000007207 transcript:ENSTBET00000007199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGERGGRNGGRSQGPGHAPDTRLLSNPWMGDVVSDWSPVHEAAIQGRLLSLKLVSQGWR
VNLITADRVTPLHEACLRGHLSCARFLLKNGAQVNAMTSYWHTPLFNACASGKLDCVNLL
LRYGASPNPENDLASPIHEAARRGYVECVEALIRHGSNVDHIVSYLGSALYLACEKQEIA
CAKKLLESGASANQGKGLDSPLHAVARVSSEELAHLLMDFGADPQAKNAEGKRPVHLVHP
ESPLAQLFLQREGPPSLMQLCRLRIRKCFGIHQHHKITELVLPERLKRFLLHL
Download sequence
Identical sequences ENSTBEP00000006218 ENSTBEP00000006218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]