SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006598 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006598
Domain Number 1 Region: 161-314
Classification Level Classification E-value
Superfamily PH domain-like 2e-41
Family Phosphotyrosine-binding domain (PTB) 0.00000284
Further Details:      
 
Domain Number 2 Region: 510-609
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-26
Family SH2 domain 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006598   Gene: ENSTBEG00000007631   Transcript: ENSTBET00000007631
Sequence length 629
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4047:546015:724621:-1 gene:ENSTBEG00000007631 transcript:ENSTBET00000007631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESISSLDEGSPGGSVGNKVSPQPPY
PTLAPHLPPEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSNPVSPETSLSRAGSAPPPQPSLVGHRATAFAADACPLPGPGEPPSRSRQDRH
FLQHLLGMGVNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGLNIKLTISTCSLTLMNVDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEV
HIDGPAEDREDHEYYNGIPGKQPPAGGISDVRIKVQASEQMVYCPIRCEKLCYLXXXXXX
XXXXXXXXXXXXXXXNAHERGLQSQREASLMKHTCRVDLFDDPCYINTQALQSTLSSARN
QSSAQLGSPWHHGKAPETVQPGATAQPASSHSIPHIKQQLWSEECYHGKLSRKAAESLLV
KDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNS
LPIISSGSEVSLIQPVKKDNNPGLLHSNK
Download sequence
Identical sequences ENSTBEP00000006598 ENSTBEP00000006598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]