SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006637 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006637
Domain Number 1 Region: 63-269
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-38
Family Ankyrin repeat 0.00068
Further Details:      
 
Domain Number 2 Region: 278-319
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006637   Gene: ENSTBEG00000007677   Transcript: ENSTBET00000007672
Sequence length 320
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_919:305406:333254:-1 gene:ENSTBEG00000007677 transcript:ENSTBET00000007672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLLTQGVNVNLVTINRVSSLHEACLGGHVACAKALLEN
GAHVNAVTVHGATPLFACCSGSVCVSVLLEFAKTSSKXXXXXXXXXXXXXXHTQCMEILL
ANNVNIDQELPRLGTPLYVACTFQQVDCVKKLLDLGASVDQGRWLDTPLHAAARQSSVEV
IDLLTSYGANLKRRNSQGKRALDVVAPKSRMEKALLRHRGPSDLSQLCRLCIRKCLGRGC
LQSVHKLQLPEPLKRFLLYQ
Download sequence
Identical sequences ENSTBEP00000006637 ENSTBEP00000006637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]