SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007144 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007144
Domain Number 1 Region: 42-92,126-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-20
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 285-327
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000471
Family SOCS box-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007144   Gene: ENSTBEG00000008242   Transcript: ENSTBET00000008245
Sequence length 328
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3227:363136:447514:-1 gene:ENSTBEG00000008242 transcript:ENSTBET00000008245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLEETRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQGPWADRSPLHEAASQGRLLALRTLLSQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLKNKVNAVTIDGVTPLFNACSQGSTSCTELLLEYGAKAQLESCLPSPTHEAAGKGH
HECLDILIAWGIDVDQDIPHLGTPLYVACMSQQFHCIWKLLYAXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPVDLATSSSVVEILLQHEATPSSLCQLCRLCI
RNYIGRPRLHLIPQLQLPTLLQNFLQYR
Download sequence
Identical sequences ENSTBEP00000007144 ENSTBEP00000007144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]