SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007408 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007408
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000121
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 2 Region: 215-279
Classification Level Classification E-value
Superfamily SH2 domain 0.000000101
Family SH2 domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007408   Gene: ENSTBEG00000008545   Transcript: ENSTBET00000008550
Sequence length 280
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3575:170854:199439:-1 gene:ENSTBEG00000008545 transcript:ENSTBET00000008550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLMAHALRRILYSTWCPADCQFAFVARNPRSPASRLFCHLFVGSQPGEAQILHLLLFRS
SQHAYLLQHPEERAQPDTYPGPAGDMPPKPPSSPGGPPVLVREPFGRDQLSQNVHALVSF
RRLPAEGPVGSGKELPELESRGVSRHARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYE
TQLQLLAREAFAAEWKERARVLGGPLFTVRGEGNLTENIWAFCETSRSCALALLRRDVLG
AFLLWPEPGASGQWCLSVRTQCGVVPHQVFRNHLGRYCLE
Download sequence
Identical sequences ENSTBEP00000007408 ENSTBEP00000007408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]