SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007541 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007541
Domain Number 1 Region: 291-432
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-31
Family SH2 domain 0.0000448
Further Details:      
 
Domain Number 2 Region: 82-145
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000101
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 5-44
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000111
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 4 Region: 561-596
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000445
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007541   Gene: ENSTBEG00000008700   Transcript: ENSTBET00000008704
Sequence length 675
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_919:529878:579930:1 gene:ENSTBEG00000008700 transcript:ENSTBET00000008704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXIVYKDGLLYVYASNEESRSQWXXXXXXXIRGNPHLLIKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXSSSSEDVVCSNQREKNIVNHSTSKISWGFPESSSSEEEENLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYYFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPVSVSLGSGIWELTREEITLL
TELGRGQLGVVLGKWAQYDVAEKMIRADSMSEDVFFQENPTMXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAEKRPTFQ
QLLSSIEPLREKDKP
Download sequence
Identical sequences ENSTBEP00000007541 ENSTBEP00000007541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]