SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007549 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007549
Domain Number 1 Region: 3163-3425
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-48
Family YWTD domain 0.00000355
Further Details:      
 
Domain Number 2 Region: 697-939
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-43
Family YWTD domain 0.0000213
Further Details:      
 
Domain Number 3 Region: 367-628
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-39
Family YWTD domain 0.0000107
Further Details:      
 
Domain Number 4 Region: 4089-4231
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-28
Family YWTD domain 0.0000612
Further Details:      
 
Domain Number 5 Region: 2360-2540
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-26
Family YWTD domain 0.0000607
Further Details:      
 
Domain Number 6 Region: 1855-1983
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-16
Family YWTD domain 0.00056
Further Details:      
 
Domain Number 7 Region: 3108-3156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000739
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 1235-1277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 9 Region: 2827-2866
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 10 Region: 3755-3795
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 11 Region: 3589-3628
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 12 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 1115-1155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 14 Region: 2707-2746
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 3038-3079
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 3681-3717
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 1078-1115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 18 Region: 73-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 2951-2992
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 3719-3756
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 21 Region: 1037-1074
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 22 Region: 153-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 1324-1372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 24 Region: 994-1031
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3547-3591
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 26 Region: 3803-3847
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 27 Region: 1156-1194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 3844-3879
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000013
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 29 Region: 235-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 30 Region: 1197-1235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000343
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 31 Region: 2783-2829
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 1361-1400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.01
Further Details:      
 
Domain Number 33 Region: 1991-2038
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000016
Family EGF-type module 0.025
Further Details:      
 
Domain Number 34 Region: 2912-2951
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 35 Region: 2991-3032
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 36 Region: 1281-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 37 Region: 3075-3115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000662
Family EGF-type module 0.011
Further Details:      
 
Domain Number 38 Region: 3638-3679
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000759
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 39 Region: 631-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.019
Further Details:      
 
Domain Number 40 Region: 3968-4003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000908
Family EGF-type module 0.011
Further Details:      
 
Domain Number 41 Region: 2750-2788
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 42 Region: 37-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 43 Region: 4341-4375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family EGF-type module 0.026
Further Details:      
 
Domain Number 44 Region: 3934-3975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000816
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000007549
Domain Number - Region: 2056-2125
Classification Level Classification E-value
Superfamily YWTD domain 0.000222
Family YWTD domain 0.0031
Further Details:      
 
Domain Number - Region: 2872-2909
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number - Region: 2312-2356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000471
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 131-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00262
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number - Region: 1613-1669
Classification Level Classification E-value
Superfamily YWTD domain 0.00759
Family YWTD domain 0.0029
Further Details:      
 
Domain Number - Region: 951-986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00914
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 3420-3481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number - Region: 4296-4321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.027
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007549   Gene: ENSTBEG00000008578   Transcript: ENSTBET00000008715
Sequence length 4613
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_460:56042:260926:-1 gene:ENSTBEG00000008578 transcript:ENSTBET00000008715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDNQHFRCGNGHCIPSAWRCDGTKDCSDDSDEAGCSHSCQVGYFQCQSGGECIPTSWCDY
EQDCEDGSDEQQNCSGRTCSSDQITCSNGQCIPGEYRCDHVRDCADGTDERDCXXXXXXX
XXXXXXXXXNTSQKCDGKADCRDFSDEVNCSAVCMHNEFRCGSGECIPRSYVCDHASDCE
DNSDEHSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSSHHFHNCYPR
EWACPESGQCILISKVCDGILDCPDGDDENSTTAGKYCXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGKPSILFSNGWDLLIGDIHGRNFQFLAESQNRGVVVGIDFHYQLRKVFWTDTVQNKVF
SVDMNNLKIQEIFNISVDAPENLAVDWVSNKLYLVETKVSRIDMANLDGSYPVTLITEDL
GHPRGIALDPTVGYLFFSDWASLSGEPKVERAFMDGSNRKVLVKTKLGWPSGITLDLASK
RVYWLDCRFDYIETVTYDGIERKTVVSGGSLIPHPFEISLFEDTVFFTDWTMMSVMTANK
FVDTNPQVYYHSSVRPYGVTVFHSLRQPYARNPCADNNGGCEQICVLSHRTDNGGLGYRC
KCTFGFNLDTDERHCVAVEKFLLFSSQLAVRGIPFTFSTQEDVMVPVTGHLSFFVGIDFD
AQENTIFFSDTSKDMIYKQKINGTGREILTANRVENVESLTFDWISKNLYWTDPTHKSIS
VMRLADKSRRAILNNLNSPRAIVVHPIAGYIFFTDWFRPAKIMRAWSDGSHLLPIVNTTL
GWPNGLAIDWSALRLYWVDAFFNKIEHSTFDGVDRRKLDHIQQMTHPFGLTVFGEHVYFT
DWRLGAIVQVRKRDGGDMTVIRRGIRNVMHVKSYDSSIQTGSNYCNRPVHPNGDCSHFCF
PVPNFQRVCGCPYGMRLSSNQLTCEGDPAREPPTEQCGSFSFPCNNGRCVPSHYRCDGFD
DCHDNSDEHLCGTSNTSCSSSSFTCAHGGQCIPARWRCDNHFDCMDESDEQNCPTRAPAS
CAESYFTCDNNVCISRDWVCDTDNDCGDGSDEKNCKSGTCRPSQFQCSDHRCIDPLYVCD
GDKDCADGSDEAGCVYNCTASQFKCANGEGCINNLYRCDGVFDCNDNSDEAGCPTRPPGM
CHLDEFQCQGDGTCIPDTWECDGHPDCIQGSDEHHGCVPKTCPSSHFSCDNGHCIYKEWL
CDGDNDCGDMSDEKDCPTQPFYCPSWQWQCPGLSICVNLSSVCDGVSDCPNGTDESPLCN
QDSCSDANGGCTHECIQGPFGAQCLCPEGYRLANDSKTCEDIDECAVLSFCSQHCYNTRG
SFRCWCDKDYRLEGDGRTCKVTASESLLLLVANRNQIVADNITAQVHNIYPLVQNGSHIV
AVDFDSISGRIFWSDSGQGKTWSAFQNGTDRRLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHVLFWTDWGRHXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIRHPYTLT
LFEDSVYWTDRATHRVMQANKWHGGNRSVVMYNIHWALGLAAIHPAKQPNXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQPFLITVRRHTVYGISLDPEVKSSD
AMVPITGIQNGFDADFDDSEQFIYWVENAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLYWSD
QGTQSGVPAKIASANMDGTDLKILFTGNFEHLEFITLDIKEQKLYWAVTSRGVIERGNVD
GTERMILVHHLSHPWGIAVHDSFLYYCDEQYEVIERVDKATGANKVVLRDNVLNLRTLRI
YHRRSIAEFSNGCSNNVNACEQICLPVPGGLFSCACATGFKLNPDNRTCSSYKSFIVVSM
MSVVRGYSLEMSDHSEAMVPVAGQGRNALHVDVDVASGFIYWCDFSSSVASRNAIRRIKP
DGSSFTNIITYGIGVNGVRGIAVDWLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIWVDRNLKKIFKASKEPGN
TEPPTVVRDNLNWLRDVTIFDEQVQPRSPTEVNNNPCLENNGGCSHLCFALPELHTPKCG
CAYGTLENDGKSCAISTENFLIFALDNSLRSLHLDPTDHSLPFQAITVERTAIALAYDNI
NNRIYFTQNLDSEHGQISYVSLNSEIHSPTVIVSDIGTADGIAFDWINRRIYYSDYNNQT
INSMAEDGSMRTVIARVSKPRAIVLDPCRGFLYWTDWDIAKIERATLGGNFRMPIVNSSL
VWPSGLVLDHEDDLLYWADASLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXFHTCQPTAFTCANGRCVQYRYRCDYYDDCGDNSDEEGCLFAECNATTEFTCNN
RRCIPLEFVCNGVNNCHDNETSDEKNCPDRMCQSGYTKCQNTNICIPRVYLCDGDNDCGD
MSDESPTYCTAHTCSSSEFKCTSGRCIPQQWHCDQEADCPDGSDEPASCVHHEQTCLSDE
FKCDSGRCISREWICDDNDCDMSDDEHHCKRNCSRSEFFCINSRPPARRCIPLSWVCDGD
ADCSDAYDEHQNCTRRSCAENEFTCANGLCILNSFRCDWRNDCGDFSDERNCSYPTCHEH
QFTCQNRCINEAYVCDGQNDCGDDSDELSHLCHTPEATCPPHQFKCDNGHCIEMVKVCNH
LDDCSDNSDEKGCGINECQDPSISGCDHNCTDTPTSFYCSCLPGYKLMSDKRTCVDIDEC
KETPFVCSQKCENVVGSYICKCAAGYIREPDGKTCRQNSNIEPYLIFSNRYYLRNLTVDG
QFYSLILQGLGNVVSLDFDRVEKRLYWIDIQRHVIERMFLNKTNREIIINHRLPAAEGLA
VDWVARKLYWVDINLNSMFVSNLDGGYRRTLAQHCVDANNTFCFDNPRGIALHPQYGYVY
WTDWGHRAYIARVGMDGTNKSVIISSKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLED
HRHTVYDGTLSHPAMTIFEDSVYWTDWNTRTVEKGNKYDGSDRTTLVNTTHRPFDIHVYH
PYRQPIVSNPCGTNNGGCSHFCLIKAGGKGFTCECPDDFQTIQQNGNTYCQPMCSSTQFL
CANNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDHVLCENHRCEPNEWQCANKRCISDAWQCDTVDDCGDNSDEDSSHCASRTCQPG
QFKCANGRCIPQTWKCDVDDDCGDQSDEPLQECMSPAYRCDNHTEFSCKTNYRCVPWWAV
CNGFDDCRDNSDEQGCEAMTCKSSGEFRCKNHHCIPLRWRCDRQDDCGDNSDEEDCVPRE
CTESEFRCANQQCIPSRWICDHDNDCGDNSDERDCEMRTCHPDYFQCTSGHCVPNRFKCD
GIADCLDASDEASCPTRFPNGAYCPTTMFECKNHVCVQKFWQCDGDDDCGDGSDEELHLC
LTVPCESPQRFRCDNNRCIYSHKLCDGVDNCGDGSDEKKEHXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXIGKERTCAENICEHNCTQLSEGGFICSCRSGFKAG
FDRNSCYDINECEQFGVCPQKCHNTKGSYECSCADGFKSMSDHYGKRCAAEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVYYTVLGQDSRFGAIKRAY
IPNFESGSNNLVQEVDLGLKYVMQPDGLAVDWVGRHIYWSDVKNQRIEVAKLDGRYRKWL
ITTQLDQPSAIVVNPKLGLMYWTDWGKEPKIESAWMNGEYRKILVSENLGWPTGLSIDYL
NNDRIYWSDFKEDVIETIKYDGTDRRIVLNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNPCKQVCSHLCLLRPGGYSCACPQGSTF
IQGSATECDAAIEAPITMPLPCRCMHGGKCYFDENNLPKCKCSSGYTGPYCEIAFSKGMP
PGTTAVAVLLTILLIIIIGALAIVGVFHYRKTGSLLPALPKLPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVTVSGNVDNKNYGSPMSPSEIAPETTPHPPAADGTQAAKWNIFKRKPKKTTNFENPIYA
EMENEQKEGVAVAPPPSPSLPANPSPRDPTPAYTATEDTFKDTAHLVKEDSEV
Download sequence
Identical sequences ENSTBEP00000007549 ENSTBEP00000007549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]