SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008175 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008175
Domain Number 1 Region: 37-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.84e-33
Family SCAN domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 452-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 648-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 396-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 693-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-16
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 9 Region: 158-203
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000131
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 10 Region: 498-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000239
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008175   Gene: ENSTBEG00000009446   Transcript: ENSTBET00000009444
Sequence length 752
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_6028:208335:236376:-1 gene:ENSTBEG00000009446 transcript:ENSTBET00000009444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSSRSHILLMWKPDKAQSGLHNVEKEMHTSRLFRDTETCRQNFRNFPYPDLAGPRKAL
SKLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEVVTLVEDLT
QILEEEVPRNSTISQETPEDDTRGRSAFQAGWRNDLATKESMTFTDVAVDITREDWELMR
PVQKELYKTVTLQNYWNMVSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWETETQACT
SVEDISKLRKVGTQTIKLEESCDYDDRLEWQATDTFRKIPTNKTNFSLKSDPSQDDDPTE
ECLRKYDIYRNNFEKHSNLIVQFDTQSDNKTSVFDGRATFSHVSYGIVHGKILPGDKPYK
CNVCGKKFRKYPSLLKHQSSHAKEKSYECEECGKEFRHISSLIAHQRMHTGEKPYECHQC
GKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYKCLECGKTF
SHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNECWKVFSQST
YLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAFSQSANLTQ
HHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQHQRI
HTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGE
KPYACRICGKSFTQSTNLIQHQRVHTGAKHRN
Download sequence
Identical sequences ENSTBEP00000008175 ENSTBEP00000008175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]