SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008273 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008273
Domain Number 1 Region: 304-370
Classification Level Classification E-value
Superfamily SH2 domain 7.94e-20
Family SH2 domain 0.0000439
Further Details:      
 
Domain Number 2 Region: 104-152
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-16
Family Phosphotyrosine-binding domain (PTB) 0.00011
Further Details:      
 
Domain Number 3 Region: 1-61
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000115
Family Phosphotyrosine-binding domain (PTB) 0.0000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008273   Gene: ENSTBEG00000009552   Transcript: ENSTBET00000009556
Sequence length 375
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3769:31012:34680:-1 gene:ENSTBEG00000009552 transcript:ENSTBET00000009556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTAEYVAYVAKDPVNQR
ACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSTQPPSHLATLPVGQPVGADSEV
CKQMPPPPCPAGRELFDDPSYVNVQNLDKARQAGGGAGPPNPAINGSAPRDLFDMKPFED
ALRVPPPLQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQ
SGQPKHLLLVDPEGV
Download sequence
Identical sequences ENSTBEP00000008273 ENSTBEP00000008273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]