SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008471 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008471
Domain Number 1 Region: 130-330
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.29e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 15-104
Classification Level Classification E-value
Superfamily WWE domain 2.22e-17
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008471   Gene: ENSTBEG00000009790   Transcript: ENSTBET00000009783
Sequence length 331
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_133171:4444:20079:1 gene:ENSTBEG00000009790 transcript:ENSTBET00000009783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHKAEEFLFKTTESEMDDMDTSETQWGWFYLAECGKWHMFQPDTNIQCSVSSEDIEKSF
KTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPP
HWENVNTEVPYQLIPLHNQTHEYNEVASLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQ
LKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGALFGKGTYFARDAAYSSRF
CKDDMKHGNTFQIHGVSLQQRHLFRTHKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNL
YDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Download sequence
Identical sequences XP_006172097.1.99106 ENSTBEP00000008471 ENSTBEP00000008471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]