SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008835 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008835
Domain Number 1 Region: 230-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.15e-63
Family Eukaryotic proteases 0.000000101
Further Details:      
 
Domain Number 2 Region: 47-99
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000379
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008835   Gene: ENSTBEG00000010225   Transcript: ENSTBET00000010215
Sequence length 486
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3597:84831:95368:-1 gene:ENSTBEG00000010225 transcript:ENSTBET00000010215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPGPRVWNYLWKSPHSASCPGMMWWLLLWGALQACPTQASVLLAQQLPQQLTSPKYPEPY
LKGQESTTDIEAPEGFAVRLIFRDFDLEPSQDCEQDFVTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGRPVIPIAQ
NHKTHGSSRAKPGNFPWQAFTNIYGRGGGALLGDRWILTAAHTIYPKDSISARRNLSVDV
FLGHTDIEEMLKRGNHPVRRVVVHPDYRQDESHNFDGDIALLELQHRVPLGPNVLPVCLP
DNETFYRSGLLGYVSGFGVEAGWLMTKLKYSRLPVAPREACEAWLRQRQSTEVFSGNMFC
VGNETQIHSACQGDSGSVYVVWDDHAHRWVATGIVSWGIGCGKGYDFYTKVLSYVDWIRR
VMDGRD
Download sequence
Identical sequences ENSTBEP00000008835 ENSTBEP00000008835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]