SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Tupaia belangeri 76 > ENSTBEP00000009129

Domain assignment for ENSTBEP00000009129 from Tupaia belangeri 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSTBEP00000009129
Domain Number 1	Region: 130-223
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	5.13e-23
Family	Ankyrin repeat	0.00099
Further Details:

Domain Number 2	Region: 20-78
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	0.000000000571
Family	Ankyrin repeat	0.0047
Further Details:

Domain Number 3	Region: 235-277
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.00000693
Family	SOCS box-like	0.0053
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSTBEP00000009129 Gene: ENSTBEG00000010548 Transcript: ENSTBET00000010554
Sequence length	278
Comment	pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4768:389747:442326:-1 gene:ENSTBEG00000010548 transcript:ENSTBET00000010554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEPQAAEGCYLGDVGFLVEGTPVQEAAQRCESLQLQQLIESRACVNQVTVDSITPLHAAS LQGQAKCVQLLLAAGAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXSSECVRLLIDAGPDLKAHECHFGTPLHVACARKHLDCVKVLLKAGTNVNAAK LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL TLSQLCRVSLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Download sequence
Identical sequences	ENSTBEP00000009129 ENSTBEP00000009129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]