SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009370 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009370
Domain Number 1 Region: 21-253
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.75e-35
Family Ankyrin repeat 0.00084
Further Details:      
 
Domain Number 2 Region: 274-320
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000405
Family SOCS box-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009370   Gene: ENSTBEG00000010838   Transcript: ENSTBET00000010834
Sequence length 321
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_346:3351:16167:1 gene:ENSTBEG00000010838 transcript:ENSTBET00000010834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEESYRSRINEKSVWCCGWL
PCTPLRIAATAGHGNCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESAQILLEAGADP
NGSRHHRSTPVYHASRVGRADILKALIRSVPYGADVDVNHHLTPDIRPPFSRRLTSLVVC
PLYISAAYHNLQCFQLLLQAGANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVS
LLVEFGANLNLVKWESLGPESRGRRKVDPEALQVFKEARSVPRTLLGLCRVAVRRALGKY
RLHLIPSLPLPDPIKKFLLYE
Download sequence
Identical sequences ENSTBEP00000009370 ENSTBEP00000009370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]