SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009641 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009641
Domain Number 1 Region: 359-424
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-21
Family SH2 domain 0.00014
Further Details:      
 
Domain Number 2 Region: 162-216
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000521
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009641   Gene: ENSTBEG00000011147   Transcript: ENSTBET00000011162
Sequence length 425
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1543:174414:361410:-1 gene:ENSTBEG00000011147 transcript:ENSTBET00000011162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKKKDLDVLEMPSIPNPFPELCCSPFTSVLSAGLFPKANLKKKQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIDHELVLVLSNWXXXXXXXXXX
XXXXXXXXXXXXXXYFFPEHMVSFATETNGEISPIQILQMFLSSSTYPEIHGFLHAKEQG
KKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDVYVSLAGKKKHGAPTNYGFC
FKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGMQLYQNYMHPYQGRSGCSSQSMSP
MRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSPTASSQSS
ASNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKH
FQIIP
Download sequence
Identical sequences ENSTBEP00000009641 ENSTBEP00000009641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]