SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010170 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010170
Domain Number 1 Region: 55-162
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 471-574
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 3 Region: 187-289
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 4 Region: 342-446
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010170   Gene: ENSTBEG00000011759   Transcript: ENSTBET00000011760
Sequence length 575
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3076:3892:12900:-1 gene:ENSTBEG00000011759 transcript:ENSTBET00000011760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKDAEMGIGLQMDEKSRGWRPADGSTALSALPPALSFLFLLPLASALQSTPLPFPELRL
VGGPSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPI
LLDNVECRGQEATLSECGSRGWGIHNCFHYEDVAVLCDEFLPTQPAIRKALISRAPTTTL
QNGKGEGSVRLVGGAGPCQGRVEILHGGLWGTVCDDDWGLPDATVVCRQLGCGAALAATT
NAFFGYGTGHILLDNVHCEGGEPRLAACLSLGWGVHNCGHHEDAGALCAVLGPPTLTALP
PSATREDWAWHTEPAATGAGAQPSGETALLTTAARVVGKKSGRLRLVGGPGPCRGRVEVL
YAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEASL
SDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGHLRLASGTH
RCEGRVELFLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNV
KCRGDESTLLLCSHIRWDVHNCDHSEDASVLCQPS
Download sequence
Identical sequences ENSTBEP00000010170 ENSTBEP00000010170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]