SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010238 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010238
Domain Number 1 Region: 373-631
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 247-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 3 Region: 35-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 4 Region: 69-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 5 Region: 290-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000712
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 6 Region: 1-31
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 326-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010238   Gene: ENSTBEG00000011814   Transcript: ENSTBET00000011833
Sequence length 898
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3684:86034:164389:-1 gene:ENSTBEG00000011814 transcript:ENSTBET00000011833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFRCRNERCIPPVWRCDEDDDCSEQSDEDDCPKKTCADSDFTCDNGHCIPERWKCDGEEE
CPDGSDESEATCTKQVCPAEKLSCGPASHKCVPASWRCDGEKDCEGGADEAGCATXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSGTCRGDEFQCGDGTCVLAIKRCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHI
CTDLKIGFECTCPAGFRLLDQKTCGDIDECEDPDACSQICVNYKGYFKCECYPGYEDTVT
KNCKAVAGKSPSLIFTNRHEVRRIDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSY
RKIYSASMDKASDLAEQKVLIDQQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGRRR
CTLFSQDLSEPRAIAVDPLRGFMYWSDWGYQAKIEKSGLNGVDRQTLVSDNIEWPNGITL
DLLNQRLYWVDSKLHQLSSIDFSGGNRKMLIFSTDFLSHPFGIAVFEDKFFWTDLENEAI
FANRLKGLEISILAENLKYPHDIFIFHELKQTKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPQSTSTTTLASTMMRTVAATTRAPGTTIHSPAYQN
HSTETPSLATAVSSSASVPRAPSLSPSTQRPATSNHSQHYGNEDGKMGSTVTAAVIGIVV
PIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXPTPALKELFVLPGPRSQLHQLPKNPLSELPVVKCK
Download sequence
Identical sequences ENSTBEP00000010238 ENSTBEP00000010238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]