SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010307 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010307
Domain Number 1 Region: 18-108
Classification Level Classification E-value
Superfamily WWE domain 6.67e-24
Family WWE domain 0.0013
Further Details:      
 
Domain Number 2 Region: 386-488
Classification Level Classification E-value
Superfamily RING/U-box 1.61e-18
Family RING finger domain, C3HC4 0.00000381
Further Details:      
 
Domain Number 3 Region: 107-181
Classification Level Classification E-value
Superfamily WWE domain 2.35e-16
Family WWE domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010307   Gene: ENSTBEG00000011903   Transcript: ENSTBET00000011907
Sequence length 616
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3076:64822:88763:1 gene:ENSTBEG00000011903 transcript:ENSTBET00000011907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAPGTSLAQVYTSPVAVAVWEWQDGLGTWHPYSATVCSYIEQQFVQQKGQRFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGIIWEWLSDDGS
WTAYEASICDYLEQQVRGNQLVYLAPLGYNYVNYATHTQTNKTPSFCRSVRRQAGPPYPV
TTVIAPPGHTGVACSCHQCLSGSGTGPVSGRYRHSMTNLPAYPIPQPPHRTIVFGTHQAF
APYNKPSLSGARSAPRLNSTNPWGGAPTTLGNQHLYRSSLSHLGPQLLPPGPSTSSGTSA
SLPSGPSSSPGSIPATVPVQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPASPPAS
CLASKSHSSVKRLRKMSVKGRTSKPEPEQVIRNYTEELRTPPDEDCIICMEKLSAASGYS
DMTDSKAIGPMAVGRLAKCSHAFHLLCLLAMYCSGNKDGSLQCPSCKTIYGEKSGTQPRG
KMEVFRFPVSLPGHEDCGTILIVYNIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGC
KVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPNYLQNVL
AELAAQGVTEDCLEPQ
Download sequence
Identical sequences ENSTBEP00000010307 ENSTBEP00000010307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]