SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011157 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011157
Domain Number 1 Region: 207-287
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000105
Family DEATH domain, DD 0.023
Further Details:      
 
Domain Number 2 Region: 36-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000369
Family TNF receptor-like 0.0065
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000127
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 293-371
Classification Level Classification E-value
Superfamily DEATH domain 0.000000366
Family DEATH domain, DD 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011157   Gene: ENSTBEG00000012883   Transcript: ENSTBET00000012875
Sequence length 401
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3422:152340:180916:-1 gene:ENSTBEG00000012883 transcript:ENSTBET00000012875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLLCCALVFLDISIKWTTQETFPPKYLHYDPETSRQLMCDKCPPGTYLKQHCTTRWKT
VCVPCPDHYYTDSWHTSDECLYCTPVCKELQYVKQECNRTHNRVCECQEGRYLEVEFCMK
HRSCPPGFGVVQAGTPERNTVCRRCPDGFFSNETSSKAPCRKHTNCSVFGLPLIRKGNAT
HDNVCSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLGVLVDNLPGTKVNAESVERI
KRRHSSQEQTFQLLKLWKHQNKDHDMVKKIIQDIDLCENSVQRHIGHTNLSFEQLLSLME
SLPGKKVGTEDIEKTMKACKSNEQIPKLLSLWRIKNGDQDTLKGLMHSLKHLKTYHFPKT
VTQSLKKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences L9LCE6
XP_006140110.2.99106 ENSTBEP00000011157 ENSTBEP00000011157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]