SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011220 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011220
Domain Number 1 Region: 177-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.67e-30
Family Ras-binding domain, RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 311-417
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000616
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000011220
Domain Number - Region: 129-256
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00523
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011220   Gene: ENSTBEG00000012917   Transcript: ENSTBET00000012950
Sequence length 655
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_508:83949:196740:1 gene:ENSTBEG00000012917 transcript:ENSTBET00000012950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVESNEDIDQMFSTLLGEMALLTQDLGVDTLPPPDPKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQQHSVSLEASNSRATASLGYGANAPATR
INQYEDDLPPPPPDPVLDLPLPPPPPEPLSQXXXXXXXXXXXXXXXXXXXXXXXXXXLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENV
VEILSDWTRDTENKVLFLEKEEKYAVFKNPQNFYLDNKGKREGKETTEKMNAKNKESLLE
ESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKSRDACFKQNVHI
HWIQCKEFQAPDRFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYGKTLYDNYQ
RAVARAGLASRWTNLGPVNTTASAQPSTGLKTGSAQPNGQIPQEAHSAGVVLQEAQRHVD
TTKDKKPALGSHDPGAPRAHPLPKSGLPPHPPVRRSSEAMGSPATPPKAKGAGGFPAPPD
NLLPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPSGGGGCEQDFMSDLMKALQKKRGNIA
Download sequence
Identical sequences ENSTBEP00000011220 ENSTBEP00000011220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]