SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011235 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011235
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.23e-51
Family N-terminal domain of cbl (N-cbl) 0.000000567
Further Details:      
 
Domain Number 2 Region: 199-285
Classification Level Classification E-value
Superfamily SH2 domain 1.93e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 291-369
Classification Level Classification E-value
Superfamily RING/U-box 7.51e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 113-198
Classification Level Classification E-value
Superfamily EF-hand 6.35e-38
Family EF-hand modules in multidomain proteins 0.00000568
Further Details:      
 
Domain Number 5 Region: 786-824
Classification Level Classification E-value
Superfamily UBA-like 0.00000536
Family UBA domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011235   Gene: ENSTBEG00000012953   Transcript: ENSTBET00000012968
Sequence length 837
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1306:7538:66011:1 gene:ENSTBEG00000012953 transcript:ENSTBET00000012968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKK
TKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKAD
AADFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFT
RLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAI
GYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQ
EQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKG
TEPIVVDPFDPRGSGGLLRQGAEGAPSPNYDEDDDERADDSLFMMKELAGAKVERPPSPF
SMAPQASLPPVPPRLDLLQQRISIPSSTSSLGAASKAAPGSLHKDKPLPIPPTLRDLPPP
PPPDRPYSIGAEARPQRRPLPCTPGECPSRDKLPPVPSSRLGDSWLPRPIPKVPVAAPSS
SEPWAGRELTNRHSLPFSLPSQMEPRADVSRLGSTFSLDTSVNMNSCPLAGPECEHPKIK
PSSSANAIYSLAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEGSLAAAHASTGPEESENEEDGYDVPKPPVPVVL
ARRTLSDISNASSSFGWLSLDGDATANFTEDSQVPERPPKPFPRRINSERRAGSCQQGGG
AAAASPQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT
Download sequence
Identical sequences ENSTBEP00000011235 ENSTBEP00000011235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]