SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012859 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012859
Domain Number 1 Region: 774-955
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.14e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 930-1049
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 15-157
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-20
Family Phosphotyrosine-binding domain (PTB) 0.026
Further Details:      
 
Domain Number 4 Region: 158-192,231-326
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000172
Family Phosphotyrosine-binding domain (PTB) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012859   Gene: ENSTBEG00000014799   Transcript: ENSTBET00000014816
Sequence length 1169
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3398:262371:482774:1 gene:ENSTBEG00000014799 transcript:ENSTBET00000014816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARRQLSPDEVSVGFSLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSRKEPG
GKQVRLCVSPSGLRCEPEPGKSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKD
NAVPQHSICHVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSSRQGAEGPSPDPAGSAALDSPGARRRPMRKSFSQPG
LRSLAFRKEFQDSGLRGARFFSSFEENDIESHLIGRHDVVQPTDMEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNPSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHVHVGEMKQASQIPENIE
SELAPSATRFRLDMLKNNTKRSLTESLESILSRGNKARGLQEPSASVDLDSSASSTLSNT
SKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFESKAHHVGDSGGTGTPVKTRRH
SWRQQIFLRVATPQKSCDSPSRYEDYSELGELPPRSPLEPVCEDGPFGPVPEERKRTSRE
LRELWRKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLS
TPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHPFQSKQQPKDVPYKGLLK
QLTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGI
LLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHE
IGPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENL
ETIVDFIKNTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQR
MDKLEKTNSSLRKQNLDLLEQLQVANSKIQSLEATVEKLLTSESKLKQAVLALELERSAL
LQEAEELRGQAAGPSRPQPSCVQPQPAGD
Download sequence
Identical sequences ENSTBEP00000012859 ENSTBEP00000012859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]