SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012878 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012878
Domain Number 1 Region: 405-429
Classification Level Classification E-value
Superfamily Notch domain 0.0000654
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000012878
Domain Number - Region: 468-495
Classification Level Classification E-value
Superfamily Notch domain 0.00471
Family Notch domain 0.0043
Further Details:      
 
Domain Number - Region: 925-996
Classification Level Classification E-value
Superfamily EF-hand 0.0066
Family Penta-EF-hand proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012878   Gene: ENSTBEG00000014813   Transcript: ENSTBET00000014840
Sequence length 1189
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4310:228560:401761:-1 gene:ENSTBEG00000014813 transcript:ENSTBET00000014840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQ
MEEEQKAMREILGKNATEPTKKXXXQLECLLTHCIKVPMLVLDPALPANITLKDLPSLYP
SFHPASDIFNVAKPKNPSTNVSVVVFDSTKDXXXXXXXXXXRNSQTIWRGYLTTDKEVPG
LVLMQDLAFLSGFPPTFKETSQLKTKLPENLSSKIKLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLSAISQSKQDEDISASRFEDNEELRYSLRSIERHA
PWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQ
KFIYLNDDVMFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSA
CDWDGGDCSGNSGGSRYVAGGGGTGNIGLGQPWQFGGGINSVSYCNQGCANSWLADKFCD
QACNVLSCGFDAGDCGQDHFHELYKVTLLPNQTHYVIPKGECLPYFSFAEIAKRGVEGAY
SDNPIIRHASIANKWKTIHLIMHSGMNATTIHFNLTFQSMSDEEFKIQITVEVDTREVPK
LNSTTQKSYENLVSPITLLPEAEILFEDIPEEKRFPKVRRHNANSTGRFQEEVKIPLVNI
SLLPKEAQLTLSKLDLQLEQGDITLKGYNLSKSALLRSFLMNLQDAKVKINQAVVTGKIN
GILEAPQEKKVDKNILQKSTEVYENLQRSTFPVVTMKVNSHYQGPNPSLNLETKTTFRSE
TQTQQVVGKDVSEEKLSSLIVPLENLVAKEKKITEKEERNRLEENAKNLTGVNSILPGRK
LQHYTESYVGFLPWEKKKYFQDLLDEEESLKTQLAYFTDSKHTGRQLKDTFADSLRYVNK
ILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYY
LMSAQPLNISVFDEVDTDQSGVLSDREIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLP
ANITQLNNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIA
FKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQF
ELPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTVFSFFAEQ
Download sequence
Identical sequences ENSTBEP00000012878 ENSTBEP00000012878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]