SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013042 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013042
Domain Number 1 Region: 41-168
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.05e-53
Family N-terminal domain of cbl (N-cbl) 0.00000179
Further Details:      
 
Domain Number 2 Region: 348-425
Classification Level Classification E-value
Superfamily RING/U-box 9.06e-43
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 3 Region: 170-254
Classification Level Classification E-value
Superfamily EF-hand 2.83e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Domain Number 4 Region: 255-341
Classification Level Classification E-value
Superfamily SH2 domain 5.69e-29
Family SH2 domain 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013042   Gene: ENSTBEG00000015009   Transcript: ENSTBET00000015025
Sequence length 895
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4316:482301:768621:-1 gene:ENSTBEG00000015009 transcript:ENSTBET00000015025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEFKIYIDSLMKKSKRA
IRLFKEGKERMYEEQSQXXRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEF
WRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQ
PWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRVSCTRLGQWAIGYVT
GXXXXXXXXXXXXXXXXXXXXXXXXXXYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYE
LYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPI
IVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTERQNSPVTSP
GSSPLAQRRKPQTDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQD
KPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHVESVPSRDQPMPLEAWCPRDAFGT
NQLVGCRLLGDGSPKPGITASSNVNGRHSRMGSDPVLMRKHRRHDLPLEGAKVFSNGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDAFDALPPSLPPPPPPARHSLIEHSKPPGS
SSRPSSGQDLFLLPSDLIIDPSSGQVPLPPARRLPGETVKSNRISQDYDQLPSSS
Download sequence
Identical sequences ENSTBEP00000013042 ENSTBEP00000013042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]