SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013275 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013275
Domain Number 1 Region: 584-688
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-24
Family SPRY domain 0.0051
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.17e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000154
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000013275
Domain Number - Region: 106-161
Classification Level Classification E-value
Superfamily RING/U-box 0.00136
Family ZZ domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013275   Gene: ENSTBEG00000015306   Transcript: ENSTBET00000015302
Sequence length 717
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3179:25347:124587:1 gene:ENSTBEG00000015306 transcript:ENSTBET00000015302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEPITAFQCPTCR
YVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSENRRERTYRPSTAMSSERISCQ
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHEN
EKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAMATASSQVLIPDINFNDAFE
NFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTI
FTGDANYISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAIGIAYKSAPKNEWI
GKNASSWVFSRCNSNFVVRHNNKEMLVDVPPQLKRLGVLLDYDNNMLSFYDPANSLHLHT
FDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences ENSTBEP00000013275 ENSTBEP00000013275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]