SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014670 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014670
Domain Number 1 Region: 725-914
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-35
Family YWTD domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 1463-1648
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-30
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 1838-2010
Classification Level Classification E-value
Superfamily Fibronectin type III 5.25e-17
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 19-109,176-364,439-505
Classification Level Classification E-value
Superfamily Sialidases 0.0000000000000549
Family Sialidases (neuraminidases) 0.046
Further Details:      
 
Domain Number 5 Region: 1320-1358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000471
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 6 Region: 1098-1137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 7 Region: 1274-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 8 Region: 1142-1175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 9 Region: 1374-1411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 1417-1454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 11 Region: 1672-1782
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000101
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 12 Region: 1184-1214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014670   Gene: ENSTBEG00000016797   Transcript: ENSTBET00000016873
Sequence length 2118
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_6026:134283:356000:1 gene:ENSTBEG00000016797 transcript:ENSTBET00000016873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFQKISEKLNFG
VGNNSEVVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTIQGFPIPFRAADLLLHSKA
ANLLLGFDRSHLNKQXXXXXXXXXXXXXXXXXXXXXXXGIDPYDKPNTIYIERHEPSGYS
TVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKAVHLLGSQQHASLQLWVSFGRKPM
RAAQFVTRHPINNIYIADASEDQAFVCVSHSNNRSNYISETEGLRFSLSLENVLYYSPGG
AGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAP
AFTGYGEKINCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFVF
SEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFGFKMSEDLAL
EVCVPDPEFSGKSYSLPVPCPVGSTYRRTRGYRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLC
LNGSTGQEVIISSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLD
RPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGSATYRLVSEDVKWPNGISVDDHWIYWT
DAYLDCIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKYTGSQMDV
LASQLTGLMDMKIFYKGKNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCE
KKCNGFRCPNGTCIPSSKHCDGLHDCSDGSDEQHCXXXCTRFMDFVCKNRQHCLFRPMVC
DGVVQCRDGSDEDPAFAGCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXNPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHFLPSPTPGP
STCLPNYFRCGSGACVMDTWVCDGYRDCADGSDEEACPSLVNVTSASTPTRLGRCDRFEF
ECRQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSSLTCTSREFKCEDGEACVVLSERCDG
FLDCSDESDEKACSDELTVYKVQNLQWTADFSGAVTLTWTRPKKMPSASCVYNVYYRVVG
ESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRN
LQLSLHREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRAASNSTEIKNLPVN
TLYTVRVAAVTSRGIGNWSDSKSITTMTGKVIPAPDIHIDSYGENSLSFTLTMGGGIKVN
GYVVNLFWAFDTHKQEKRTLNFRGGVSSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHV
LTRGTRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSWTTPLHNAT
VIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHAVRTGKTSVAIKWESPY
DSPDQDLLYAIAVKDLVRKTERSYKVRSRNSTVEYTLSKLEPGGKYHIVVQLGNMSKDSS
IKVTTVSLSAPDALKIITENDHVLLFWKSLALKEKQFNESRGYEIHMFDSAMNITAYLGN
TTDNFFKISNLKMGHNYTFTVQARCLLGSQLCGEPAALLYDELGSGGDASAVQAARSTDV
AAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDD
EDAPMITGFSDDVPMVIA
Download sequence
Identical sequences ENSTBEP00000014670 ENSTBEP00000014670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]