SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000093 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000093
Domain Number 1 Region: 181-272
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-21
Family UBX domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000093   Gene: ENSTTRG00000000101   Transcript: ENSTTRT00000000101
Sequence length 273
Comment pep:novel genescaffold:turTru1:GeneScaffold_628:673:25859:1 gene:ENSTTRG00000000101 transcript:ENSTTRT00000000101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRGVVGVFLLAALPLLCLELPRGIPDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPQEMKLKKLEERFYRM
TGETWKLSHGHKLGGDKDLVLESESQTSSETSNREAAKRRNLPKPVTKVSPPAEQPTQKE
VLDLPEEPPEIAEEVVTVALRCPSGRVLRRSFKSCSSQVLFDWMMKIGYHTSLYSLSTSF
PRRALEVERGWSLQDVGITVDTVLNVEEKEQSN
Download sequence
Identical sequences ENSTTRP00000000093 ENSTTRP00000000093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]