SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000275 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000275
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 192-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 350-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-19
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.14e-18
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000275   Gene: ENSTTRG00000000293   Transcript: ENSTTRT00000000293
Sequence length 403
Comment pep:novel genescaffold:turTru1:GeneScaffold_3312:72910:87099:-1 gene:ENSTTRG00000000293 transcript:ENSTTRT00000000293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVTFKDVAVTFTREEWGQLDLQRTLYQEVMLEICGLLVSLGHPVPKPELIHLLEHGQEL
WMGRRGLPHSMCPDDRAKRQTRELVLSEGVLLQGSLTLGSSRDCRSRQAMDPEGLLEVQK
GQLRPETDAHKETHPGKTSLEDDGLEADDGVHSRAFQERVSQGDVLCERDPQGPGKGPLI
HNLYKCKQCGKSFNRKWYLVRHQRIHTGMKPYECNACGKAFSQSSTLTRHYVIHTGETPY
KCAECGKAFKRRSYLLQHQPIHTGEKPYECGQCRKAFTHRSTFIRHNRTHTGEKPFECKE
CEKSFSNRAHLIQHYIIHTGEKPYDCTECGKAFRCSSELLQHQRIHTGEKPYECAQCGKA
FHRSTYLIQHSVIHTGETPYKCAECGKAFKRRSHLLQHQRVHT
Download sequence
Identical sequences ENSTTRP00000000275 ENSTTRP00000000275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]