SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000360 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000360
Domain Number 1 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-26
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.61e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 256-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 519-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000019
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000360
Domain Number - Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000275
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number - Region: 559-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00247
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000360   Gene: ENSTTRG00000000387   Transcript: ENSTTRT00000000386
Sequence length 596
Comment pep:novel genescaffold:turTru1:GeneScaffold_3633:91330:104746:-1 gene:ENSTTRG00000000387 transcript:ENSTTRT00000000386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQGLLTFRDVAIEFSQEEWECLDPAQRALYRDVMLETYRNLLSLGEDNTPPEVDTSI
SFLTKELLKKKNINNRELYQSVVLGRHGSHGIEDFDFSKVRGTVYEFENKCGCEERNSKG
ELMTDNINHTGRKDKQYSKSWINLPLKQSVSLRKSACQYLKNSKSFIKNLLKIKNNIVYA
GNKYPEHFDNRTGLSFQSHLAELQRFQTEEKIYECNQVEKSVKTCSSISSLQRFPPSVKT
NICNTYGKVSSFIPVYPSLLTQQQKTNIREKLYECSECGKTFIHHSVLTSHQRIHSEQRP
YKCNECSKAFKQFSNLTRHQRIHTGEKPYKCNICDKVFNQNSHLTNHWRIHTGEKPHKCN
ECGKAFIKCSDLWRHERIHTGEKPYKCNECGKGFTKRSYLWDHQRIHTGEKPYKCNECGK
AFKQCSHLTKHQNVHPGEKPHKCTVCGKAFIHTSSLVKHQKIHTGEKPYKCNECGKAFIQ
SSSLTEHQRIHTGEKPYKCSECGKAFTVCSSLTKHKRNHTGEKPYKCNECDKAYTQFVHL
TRHQKIHTKKKNHEPNVPDNAFIQSSSLEDYQRIHGREKPYKCNEAKLNWCSRLTR
Download sequence
Identical sequences ENSTTRP00000000360 ENSTTRP00000000360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]