SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000435 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000435
Domain Number 1 Region: 495-505,538-916
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 9.55e-79
Family Formin homology 2 domain (FH2 domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 58-280
Classification Level Classification E-value
Superfamily ARM repeat 9.3e-25
Family Diap1 N-terninal region-like 0.038
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000435
Domain Number - Region: 485-524
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0785
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000435   Gene: ENSTTRG00000000463   Transcript: ENSTTRT00000000463
Sequence length 1074
Comment pep:novel scaffold:turTru1:scaffold_110090:169442:176994:1 gene:ENSTTRG00000000463 transcript:ENSTTRT00000000463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEDCALQVSPSGYYLDPELSLEEQREMLEGFFEEISKGRKPTLILRTQLSLRVNAILEKL
YGSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIHVGAAADHNYQSYILRALGQL
MLFVDGMLGVVAHSETVQWLYTLCASLSRLVVKTALKLLLVFVEYSESNAPLFIRAVNSV
ASTTGALPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGME
ALVQRHLGTAGTDVDLRAQLMLYESTLRLEDGDMEEAVTGGRRITRRKPSSEEGRIRRSL
EVRSPEPGPVGPAPPTGPASSAVGPVSGLHTTLSLFPTISVTPSPNSSCERSIYXXXXXX
XXXXAETEKQAALAQGQAETLAGAMHDDIDGHPDTQELRGSPEPAPAPGTPQSAAPQILL
RTRHSLEPEPKEPLAPPSPKAEPIREIPTSVPSLCIGDLDFSDLGEDEDQDVLNTESVEA
GKGVPPPPPPLPGGPPPPPPPPPPPIKSSFPPPPPAAALPPSAPDGLALPTKRKTVKLFW
RELKLAGVHGGSGSRFGPCPTLWASLEPVSVDTARLEHLFESRAKDVLPSKKAGEGRRTV
TTVLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLLTMMPTEEERQKIEE
AQLANPDIPLGPAENFLMTLASIRGLAARLQLWAFKLDYDSMEREIAEPLFDLKVGMQQL
VQNATFHCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLHHLCSLVLQTR
PDSSDLYSEIPALIRCAKVDFEQLTENLGQLERRSRAAEESLRSLSKHELAPALRARLTH
FLAHCTRRVAMLRVVHRRVCNRFHAFLLYLGYTAETAREARVMQFCHTLREFALEYRTCR
DRVLQQQQKRATYRERNKTRGRMITETEKFSGVAAGETPSNPSIPVAVSSSGEGDADSHA
SMKSLLASKPEDTTHGRRSRGMVQSSSPVMPTAVGPCTVPPEEPPGSSLPSDTSDEIMDL
LVQSVTKSSPRASAARERKRSRGNRKSLRRTLKSGLGEDLVQALGLSKGPGLEV
Download sequence
Identical sequences ENSTTRP00000000435 ENSTTRP00000000435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]