SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000517 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000517
Domain Number 1 Region: 186-327
Classification Level Classification E-value
Superfamily PH domain-like 1.27e-42
Family Third domain of FERM 0.000000404
Further Details:      
 
Domain Number 2 Region: 474-567
Classification Level Classification E-value
Superfamily Moesin tail domain 1.44e-25
Family Moesin tail domain 0.0018
Further Details:      
 
Domain Number 3 Region: 70-188
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-24
Family Second domain of FERM 0.00000877
Further Details:      
 
Domain Number 4 Region: 10-74
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-20
Family First domain of FERM 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000517   Gene: ENSTTRG00000000552   Transcript: ENSTTRT00000000551
Sequence length 567
Comment pep:novel genescaffold:turTru1:GeneScaffold_493:113200:181390:1 gene:ENSTTRG00000000552 transcript:ENSTTRT00000000551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAKGSACVMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKE
EPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAK
YGDYDPSVHKRGFLAQEELLPKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEAEMEYLK
IAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDK
EFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEK
ARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQ
ITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAK
EADQLKQDLQEAREAERRAKQKLLEITTKPTYPPMNPLPAPLPPDIPSFNLIGDSLSFDF
KDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDQG
GTSSKHNTIKKLTLQSAKSRVAFFEEL
Download sequence
Identical sequences ENSTTRP00000000517 ENSTTRP00000000517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]