SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000587 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000587
Domain Number 1 Region: 224-303
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 4.45e-23
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0014
Further Details:      
 
Domain Number 2 Region: 364-459
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000863
Family UBX domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000587
Domain Number - Region: 79-149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000587   Gene: ENSTTRG00000000625   Transcript: ENSTTRT00000000625
Sequence length 472
Comment pep:novel genescaffold:turTru1:GeneScaffold_3316:110339:128244:-1 gene:ENSTTRG00000000625 transcript:ENSTTRT00000000625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLASLGKTRRVPLHSEPVNPGRRDIKMYGNEDEVDVLNDAHGSEERISVPSCYGGIGA
PVSRHVPVYHDSELMATMARKVQDLERQVKAQADEMLSKDQKIRALEELVETLQEHQGTV
TLQRQEELETTCAQLQRQVGEMERFLGDYGLQWVGEPMHEEDSEDGERDWMTAKKFWKPG
DSLVPPEVDFDRLLASLKDLSELAVDSDTQLTPMPSRVPHCVLEPIPLKLYRNGIVMFDG
PFRPFHDPSTQRCLRDILDGFFPSELQRLYPDGVPFKVSDLRNQVYPENGLDPFPGEGRV
VGWQRIRKPLDRMEHPGSRMTAEKFLNRLPKLVIRQGEVIDIRGPIRDTLKCPLCVQIQE
IVVETPALAAERERSQESPESPVPALSTLRIKSENGEQAFLLLMRPEDTVGDVRTLLAQA
RAVEATTFEIFSTFPPTVYHNDALTLQAAGLVPNATLLLRARRAPLPAPGPE
Download sequence
Identical sequences ENSTTRP00000000587 ENSTTRP00000000587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]